HORDB

ID: hor002383
Uniprot ID: O46617
Protein name: Motilin-associated peptide
Gene name: MLN
Organism: Equus caballus (Horse)
Family: Motilin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031788 motilin receptor binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: SLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEIGMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK
Length: 68
Propeptide: FVPIFTYSELQRMQEKERNRGQKKSLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEIGMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q8CIT0-F1.pdb

hor002383_AF2.pdb

hor002383_ESM.pdb

Mass:	860964	Formula:	C317H534N90O109S2
Absent amino acids:	CFHW	Common amino acids:	EL
pI:	4.41	Basic residues:	8
Polar residues:	17	Hydrophobic residues:	23
Hydrophobicity:	-43.82	Boman Index:	-13193
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	96.18
Instability Index:	5115.15	Extinction Coefficient cystines:	1490
Absorbance 280nm:	22.24